PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G234600.1.p
Common NameGLYMA_04G234600, LOC102670540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 250aa    MW: 28558.8 Da    PI: 8.5927
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G234600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK75.56.3e-24141188552
               RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          +++++++k+F  pi++AAk L+v+lT+LKr+CR++++kRWPhRk+ksl
  Glyma.04G234600.1.p 141 LKFDEIRKHFGVPITEAAKRLNVGLTMLKRRCRELNVKRWPHRKLKSL 188
                          899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.768126209IPR003035RWP-RK domain
PfamPF020427.0E-22141188IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGFVFVSDHD IVPHTFNSSF SSAQVNHTHK IMEISPLEGF SELDWPYSSN HLCFNEFPDL  60
ENLDLDFSLP PLGEYLEEEL DQKPLNIVVS QGVHCNREKG FGEASSFTIE NGSATASYVQ  120
NIIRQRPQPV SSSSKKKTCV LKFDEIRKHF GVPITEAAKR LNVGLTMLKR RCRELNVKRW  180
PHRKLKSLQL LIDNVKEMGL EDEVARVEKH KRLLEKLPGM ELSEEAKKLR QACFKANYKK  240
RRCMASLQA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1883707e-59AC188370.9 Glycine max cultivar PI 96983 clone gmp1-120k16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578896.10.0PREDICTED: protein RKD4-like isoform X1
TrEMBLK7KLW80.0K7KLW8_SOYBN; Uncharacterized protein
STRINGGLYMA04G41320.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-39RWP-RK domain-containing protein